DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and DLX3

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_005211.1 Gene:DLX3 / 1747 HGNCID:2916 Length:287 Species:Homo sapiens


Alignment Length:328 Identity:120/328 - (36%)
Similarity:144/328 - (43%) Gaps:125/328 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GGQDSGFPS-PRSA---LGYPFPPMHQNSYSG-----------YH----------LGSYAPPC-- 96
            |.:||  |: |.|:   |||...|.| :.|||           ||          .|:|:|..  
Human    25 GSKDS--PTLPESSVTDLGYYSAPQH-DYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEY 86

  Fly    97 ---AS------------PPKDDFSISDKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRT 146
               ||            |.:|..|:.::.|.....||||.||:|||||||||.||..|.||||:.
Human    87 TYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKA 151

  Fly   147 QYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKAAQGPGTNSGMPLGGGGPNPGQHSPNQ 211
            |||||||||||||.||||||||||||||||||:||:.|       |..:||        :|||| 
Human   152 QYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYK-------NGEVPL--------EHSPN- 200

  Fly   212 MHSGELANGRFLWAALETNGTLALVHSTGGNNGGGSNSGSPSHYLPPGHSP-----TPSSTPV-- 269
                                                ||.|.:...||  ||     :..|||.  
Human   201 ------------------------------------NSDSMACNSPP--SPALWDTSSHSTPAPA 227

  Fly   270 -SELSPEFP----PTGLSPPTQAPWDQKPHWIDHKPPPQMTPQPPHPAATLHPQTHHH---NPPP 326
             |:|.|..|    |:.|..||.: |    :...:...|.:..|||.||      |.||   .|||
Human   228 RSQLPPPLPYSASPSYLDDPTNS-W----YHAQNLSGPHLQQQPPQPA------TLHHASPGPPP 281

  Fly   327 QMG 329
            ..|
Human   282 NPG 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 45/52 (87%)
DLX3NP_005211.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..39 6/15 (40%)
DLL_N 27..107 CDD:403572 21/82 (26%)
COG5576 <109..232 CDD:227863 76/176 (43%)
homeobox 129..188 49/58 (84%)
Homeobox 132..186 CDD:395001 45/53 (85%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..287 37/148 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153149
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I4345
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416398at2759
OrthoFinder 1 1.000 - - FOG0000655
OrthoInspector 1 1.000 - - otm40491
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24327
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.