DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and DLX1

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_835221.2 Gene:DLX1 / 1745 HGNCID:2914 Length:255 Species:Homo sapiens


Alignment Length:277 Identity:109/277 - (39%)
Similarity:136/277 - (49%) Gaps:67/277 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TAASVTPGINIP--GKSAFVEL----QQHAAA----GYGGIRSTYQ--HFGPQGGQD--SGFPSP 68
            |..::...:|.|  ||:.|:|.    ||.:.:    |:..:...:.  |..|.|...  |.|..|
Human     2 TMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSASSFSRP 66

  Fly    69 RSALGYPFPPMHQNSYSGYHLGSYAPPCASPPKDDFSISDKCEDSG-------------LRVNGK 120
               ||||:    .||.|.:....|.....|.|........:.||.|             :|.|||
Human    67 ---LGYPY----VNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVRFNGK 124

  Fly   121 GKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMK- 184
            |||:|||||||||||||.||||||:|||||||||||||||||||||||||||||:|||:||:|| 
Human   125 GKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQ 189

  Fly   185 ---AAQGPGTNSGMPLGGGGPN-PGQHSPNQMHSGELANGRFLWAALETNGTLALVHSTGGNNGG 245
               |.:|....:|..|..|.|. |...:||.                          |:|..:||
Human   190 GGAALEGSALANGRALSAGSPPVPPGWNPNS--------------------------SSGKGSGG 228

  Fly   246 GSNSGSPSH--YLPPGH 260
            .:.|..||:  :.|..|
Human   229 NAGSYIPSYTSWYPSAH 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 49/52 (94%)
DLX1NP_835221.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38 9/35 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..118 3/22 (14%)
Homeobox 131..185 CDD:395001 49/53 (92%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..230 10/51 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153144
Domainoid 1 1.000 109 1.000 Domainoid score I6359
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416398at2759
OrthoFinder 1 1.000 - - FOG0000655
OrthoInspector 1 1.000 - - otm40491
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24327
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X884
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.