DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and NKX6-3

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001351770.1 Gene:NKX6-3 / 157848 HGNCID:26328 Length:265 Species:Homo sapiens


Alignment Length:175 Identity:54/175 - (30%)
Similarity:89/175 - (50%) Gaps:23/175 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 AGYGGIRSTYQHFGPQGGQDSGFPSPRSALGYPFPPMHQNSYSGYHLGSYAPPCASPPKDDFSIS 107
            ||:||:.|...::.||.|.       .|..|..:|...:|             |.:....|:...
Human    78 AGFGGLSSQGVYYSPQVGN-------FSKAGNEYPTRTRN-------------CWADTGQDWRGG 122

  Fly   108 DKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWF 172
            .:|.::...::....|.:..|..::..|:..|.:.|::|:|||.||||.||.|||:|::|||:||
Human   123 RQCSNTPDPLSDSIHKKKHTRPTFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWF 187

  Fly   173 QNRRSKYKKMMKAAQGPGTNSGMPLGGGGPNP-GQHSPNQMHSGE 216
            ||||:|::|  |:|..|.:::....||.|... |..:|::....|
Human   188 QNRRTKWRK--KSALEPSSSTPRAPGGAGAGAGGDRAPSENEDDE 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 28/52 (54%)
NKX6-3NP_001351770.1 Homeobox 142..195 CDD:306543 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.