DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and Hoxa1

DIOPT Version :10

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_034579.3 Gene:Hoxa1 / 15394 MGIID:96170 Length:336 Species:Mus musculus


Alignment Length:66 Identity:19/66 - (28%)
Similarity:23/66 - (34%) Gaps:20/66 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 DATQLINKLPTPLEESKTADNNSTMPEPETMRIAFRYNQLTPVDSEQKPATSLGHYFDLTKTMSP 148
            |.||:      |.|:|  |..||:.            ..|.|.|||....|..||..:.....|.
Mouse   155 DLTQI------PSEQS--AIFNSSR------------RALPPADSEPYKQTGEGHEEETDGIFSE 199

  Fly   149 D 149
            |
Mouse   200 D 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeodomain 125..181 CDD:459649 9/25 (36%)
Hoxa1NP_034579.3 COG5576 177..>287 CDD:227863 8/24 (33%)
Homeodomain 234..287 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.