DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and Nkx6-2

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_899071.2 Gene:Nkx6-2 / 14912 MGIID:1352738 Length:277 Species:Mus musculus


Alignment Length:242 Identity:73/242 - (30%)
Similarity:109/242 - (45%) Gaps:51/242 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GGNTAASVTPGINIPGKSAFVELQQHAAAGYGGIRSTYQHFGPQGGQDSGFPSPRSAL-GYP--- 75
            ||....|: |.:|....||.|                  :|||......|:|.|.:.| |.|   
Mouse    72 GGGLLGSL-PRLNGLASSAGV------------------YFGPAAAVARGYPKPLAELPGRPPIF 117

  Fly    76 FPPMHQNSYSGYHLGSYAPPCASPPKDDFSISDKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLN 140
            :|.:.|.|                |..|..::...:..|: ::..||| :..|..:|..|:..|.
Mouse   118 WPGVVQGS----------------PWRDPRLAGSAQAGGV-LDKDGKK-KHSRPTFSGQQIFALE 164

  Fly   141 RRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKM----MKAAQGPGTNSGMPLGGGG 201
            :.|::|:|||.||||.||.|||:|::|||:||||||:|::|.    |.:|:....:....|..||
Mouse   165 KTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAEMASAKKKQDSDAEKLKVGG 229

  Fly   202 PNPGQ----HSPNQMHSGELANGRFLWAALETNGTLALVHSTGGNNG 244
            .:...    :.|...:|.:....|.|.....:|  ||||...||:.|
Mouse   230 SDAEDDDEYNRPLDPNSDDEKITRLLKKHKPSN--LALVSPCGGSAG 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 29/52 (56%)
Nkx6-2NP_899071.2 Homeobox 151..205 CDD:395001 29/53 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.