DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and Emx1

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_034261.1 Gene:Emx1 / 13796 MGIID:95387 Length:257 Species:Mus musculus


Alignment Length:257 Identity:78/257 - (30%)
Similarity:109/257 - (42%) Gaps:77/257 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DGGN---------------TAASVTP----GINIP----GKSAFVE-LQQHAAAGYGGIRSTYQH 54
            |||.               .|||..|    .:|.|    .::|||. ....||||.|  ||.|  
Mouse    19 DGGTGGSPGSGGAGSHPLAVAASEEPLRPTALNYPHPSAAETAFVSGFPAAAAAGAG--RSLY-- 79

  Fly    55 FGPQGGQDSGFPSPRSALGYPFPPMHQNSYSGYHLGSYAPPCASPPKDDFS-------------- 105
                ||.:..||   .|:.:|...:|    ..:.|||.:   ..||...||              
Mouse    80 ----GGPELVFP---EAMNHPALTVH----PAHQLGSSS---LQPPHSFFSAQHRDPLHFYPWVL 130

  Fly   106 ----------ISDKCEDSGLRVNGK-GKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAA 159
                      .||..:| ||.::|. .:|.::.||.:|..||.:|.|.|::..|:...||.:||.
Mouse   131 RNRFFGHRFQASDVPQD-GLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAG 194

  Fly   160 SLGLTQTQVKIWFQNRRSKYKKMMKAAQGPGTNSGMPLGGGGPNPGQHSPNQMH-SGELANG 220
            ||.|::||||:||||||:|||:.....:||.:..        ...|.|..|:.. :.:.|||
Mouse   195 SLSLSETQVKVWFQNRRTKYKRQKLEEEGPESEQ--------KKKGSHHINRWRIATKQANG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 27/52 (52%)
Emx1NP_034261.1 COG5576 108..>218 CDD:227863 40/110 (36%)
Homeobox 163..215 CDD:278475 27/51 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..257 8/41 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.