DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and Dlx4

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_031893.3 Gene:Dlx4 / 13394 MGIID:94904 Length:240 Species:Mus musculus


Alignment Length:231 Identity:93/231 - (40%)
Similarity:117/231 - (50%) Gaps:49/231 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PGKSAFVELQQHAAAGYGGIRSTYQHFGPQGGQDSGFPSPRSALGYPFPPMHQNSYSGYHLGSYA 93
            ||.:|..:|..  :..||..|| |.|.||....||..|..:..:. |..|.|:.:.....|.:.:
Mouse    37 PGTAASPDLSY--SQSYGHPRS-YSHPGPATPGDSYLPRQQQLVA-PSQPFHRPAEHPQELEAES 97

  Fly    94 PPCASP--PKDDFSISDKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAE 156
            ...|..  |....|::              :|:|||||||||||||.||:|||.||||||||||:
Mouse    98 EKLALSLVPSQQQSLT--------------RKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQ 148

  Fly   157 LAASLGLTQTQVKIWFQNRRSKYKKMMKAAQGPGTN--SGMPLGGGGPNPGQHSPNQMHSGELAN 219
            |||.||||||||||||||:||||||::|.:.|....  ||.|     |:...|||..        
Mouse   149 LAAQLGLTQTQVKIWFQNKRSKYKKLLKQSSGEPEEDFSGRP-----PSLSPHSPAL-------- 200

  Fly   220 GRFLWAALETNGTLALVHSTGGNNGGGSNSGSPSHY 255
             .|:| .|....||.   |:|.:|         ||:
Mouse   201 -PFIW-GLPKADTLP---SSGYDN---------SHF 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 46/52 (88%)
Dlx4NP_031893.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..70 11/28 (39%)
Homeobox 119..172 CDD:278475 46/52 (88%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..194 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843253
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416398at2759
OrthoFinder 1 1.000 - - FOG0000655
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24327
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.900

Return to query results.
Submit another query.