Sequence 1: | NP_001137759.1 | Gene: | Dll / 37973 | FlyBaseID: | FBgn0000157 | Length: | 347 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_031700.1 | Gene: | Cdx4 / 12592 | MGIID: | 88362 | Length: | 282 | Species: | Mus musculus |
Alignment Length: | 280 | Identity: | 75/280 - (26%) |
---|---|---|---|
Similarity: | 106/280 - (37%) | Gaps: | 106/280 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 ASVTPG-INIPGKSAFVELQQHAAAGYGGIRSTYQHFGPQGGQDSGFPSPRS----ALGYP---- 75
Fly 76 FPPMHQNSYSGYHLGSYAPPCASPPKDDF------------------------------------ 104
Fly 105 -----SISDKCE------DSG---------------------LRVNGKGKKMRKPRTIYSSLQLQ 137
Fly 138 QLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKAAQGPGTNSGMPLGGGGP 202
Fly 203 NPGQHSPNQMHSGELANGRF 222 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dll | NP_001137759.1 | Homeobox | 127..180 | CDD:278475 | 23/52 (44%) |
Cdx4 | NP_031700.1 | Caudal_act | 13..160 | CDD:309740 | 33/167 (20%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 13..36 | 10/42 (24%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 98..156 | 5/57 (9%) | |||
Homeobox | 175..227 | CDD:306543 | 23/51 (45%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0850 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |