DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and Cdx1

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_034010.3 Gene:Cdx1 / 12590 MGIID:88360 Length:268 Species:Mus musculus


Alignment Length:289 Identity:79/289 - (27%)
Similarity:107/289 - (37%) Gaps:72/289 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 APHTPKYMD-GGNTAASVTPGINIPGKSAFVELQQHAAAGYGGIRSTYQHFGPQGGQDS----GF 65
            ||..|:|.| .|.|.....|.......:.|...:...||.||.        ||.....|    .|
Mouse    36 APAPPQYPDFAGYTHVEPAPAPPPTWAAPFPAPKDDWAAAYGP--------GPTASAASPAPLAF 92

  Fly    66 PSPRSALGYPFPPMHQNSYSGYHLGSYAPPCA--SPPKDDFS-ISDKCEDSGLRVNGKGKKMRKP 127
            ..|......|.||..........||:...|.:  :|.:..:. :......:|...:||.:...|.
Mouse    93 GPPPDFSPVPAPPGPGPGILAQSLGAPGAPSSPGAPRRTPYEWMRRSVAAAGGGGSGKTRTKDKY 157

  Fly   128 RTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKAAQG---- 188
            |.:|:..|..:|.:.|..::|:.:..::||||:||||:.||||||||||:|.:|:.|..|.    
Mouse   158 RVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKKKQQQQQP 222

  Fly   189 -PGTNSGMPLGGGGPNPGQHSPNQMHSGELANGRFLWAALETNGTLALVHSTGGNNGGGSNSGSP 252
             |.|...:|| .|.|.|                                            ||.|
Mouse   223 LPPTQLPLPL-DGTPTP--------------------------------------------SGPP 242

  Fly   253 SHYLPP---GHSPTPSSTPVSELSPEFPP 278
            ...|.|   |...|||..||.|   ||.|
Mouse   243 LGSLCPTNAGLLGTPSPVPVKE---EFLP 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 25/52 (48%)
Cdx1NP_034010.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..152 28/123 (23%)
Caudal_act 13..138 CDD:282574 25/109 (23%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P47902 157..178 5/20 (25%)
Homeobox 158..210 CDD:278475 25/51 (49%)
Interaction with 5-mCpG DNA. /evidence=ECO:0000250|UniProtKB:P47902 196..207 9/10 (90%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..268 24/106 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.