DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and Vsx1

DIOPT Version :10

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_473409.1 Gene:Vsx1 / 114889 MGIID:1890816 Length:363 Species:Mus musculus


Alignment Length:123 Identity:40/123 - (32%)
Similarity:62/123 - (50%) Gaps:10/123 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 SGFPSPRSALGYPFPPMHQNSYSGYHLGSYAPPCASPPKDDFSISDKCEDSGLR-VNGKGKKMRK 126
            |..|.|..|.|...||.        .|||.....:....|..|.|::..|..:. :.||.|| |:
Mouse   118 SAGPEPAVAQGPVHPPP--------ALGSQQRSESVSTSDGDSPSEEKNDPKMSLILGKRKK-RR 173

  Fly   127 PRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMK 184
            .||::::.||::|.:.|....|..:..|..|||...|.:.::::||||||:|::|..|
Mouse   174 HRTVFTAHQLEELEKAFGEAHYPDVYAREMLAAKTELPEDRIQVWFQNRRAKWRKREK 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeodomain 125..181 CDD:459649 20/55 (36%)
Vsx1NP_473409.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Octapeptide motif 31..38
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..66
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..166 12/51 (24%)
Nuclear localization signal. /evidence=ECO:0000255 168..173 3/5 (60%)
Homeodomain 172..228 CDD:459649 20/55 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..363
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.