DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and CDX4

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_005184.1 Gene:CDX4 / 1046 HGNCID:1808 Length:284 Species:Homo sapiens


Alignment Length:218 Identity:63/218 - (28%)
Similarity:97/218 - (44%) Gaps:29/218 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 APHTPKYMDGGNTAASVTPGINIPGKS-AFVELQQHAAAGYGGIRSTYQHFGPQGGQDSGFPSPR 69
            :|::|...|.     ||.||   |..: ..|.:....::......:.|.:.||.||..||...|.
Human    74 SPYSPPREDW-----SVYPG---PSSTMGTVPVNDVTSSPAAFCSTDYSNLGPVGGGTSGSSLPG 130

  Fly    70 SALGYPFPPMHQNSYSGYHLGSYAPPCASPPKDDFSISDKCEDSGLRVNGKGKKMRKPRTIYSSL 134
            .|.|...|           ..:.|...:||.:...|.......: ::|.||.:...|.|.:|:..
Human   131 QAGGSLVP-----------TDAGAAKASSPSRSRHSPYAWMRKT-VQVTGKTRTKEKYRVVYTDH 183

  Fly   135 QLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKAAQGPGTNSGMPLGG 199
            |..:|.:.|...:|:.:..::|||.:|||::.||||||||||:|.:||:|.......|||..:  
Human   184 QRLELEKEFHCNRYITIQRKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFENSGGSV-- 246

  Fly   200 GGPNPGQHSPNQMHSGELANGRF 222
                  |...:.:..|||.|..|
Human   247 ------QSDSDSISPGELPNTFF 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 23/52 (44%)
CDX4NP_005184.1 Caudal_act 13..162 CDD:309740 24/106 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 15..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..155 11/45 (24%)
Homeobox 177..229 CDD:306543 23/51 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..259 6/28 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.