DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and CDX2

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:XP_011533177.1 Gene:CDX2 / 1045 HGNCID:1806 Length:321 Species:Homo sapiens


Alignment Length:347 Identity:88/347 - (25%)
Similarity:123/347 - (35%) Gaps:137/347 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PKYMD--GGNTAASVTPGINI-----PGKSAFVELQQHAAAGYGG-IRSTYQHFGPQG------- 59
            |:|.|  |.:.||:.....|:     ||.|        ..|.||. :|..:..:.|.|       
Human    35 PQYPDYGGYHVAAAAAAAANLDSAQSPGPS--------WPAAYGAPLREDWNGYAPGGAAAAANA 91

  Fly    60 ---GQDSGFPSPRSALGYPFP----PMHQNSYSGYHLGSYAPPCAS----------PPKDDFSIS 107
               |.:.|  ||.:|:||..|    |.|...:..:|..: ||.|||          |.....:.:
Human    92 VAHGLNGG--SPAAAMGYSSPADYHPHHHPHHHPHHPAA-APSCASGLLQTLNPGPPGPAATAAA 153

  Fly   108 DKCEDSGLRVNGKGKKMRKP-------------------------RTIYSSLQLQQLNRRFQRTQ 147
            ::....|.|.| ..:.||||                         |.:|:..|..:|.:.|..::
Human   154 EQLSPGGQRRN-LCEWMRKPAQQSLGSQALTSPSSTVKTRTKDKYRVVYTDHQRLELEKEFHYSR 217

  Fly   148 YLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMK------AAQGPGTNSGMPLGGGGPNPGQ 206
            |:.:..:|||||:|||::.||||||||||:|.:|:.|      ..|.|......|     |.|.|
Human   218 YITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPP-----PQPPQ 277

  Fly   207 HSPNQMHSGELANGRFLWAALETNGTLALVHSTGGNNGGGSNSGSPSHYLPPGHSPTPSSTPVSE 271
            ..|..:.|                                              .|.|.| |||.
Human   278 PQPGPLRS----------------------------------------------VPEPLS-PVSS 295

  Fly   272 LSPEFP--------PTG--LSP 283
            |....|        |||  |:|
Human   296 LQASVPGSVPGVLGPTGGVLNP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 26/77 (34%)
CDX2XP_011533177.1 Caudal_act 13..171 CDD:282574 37/147 (25%)
Homeobox 198..250 CDD:278475 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.