DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and rax2

DIOPT Version :10

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:XP_002941436.1 Gene:rax2 / 100494721 XenbaseID:XB-GENE-494483 Length:227 Species:Xenopus tropicalis


Alignment Length:36 Identity:10/36 - (27%)
Similarity:17/36 - (47%) Gaps:0/36 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 NYARVLSKYFLAEGIVNKHPLVVAIMDEDATQLINK 91
            ||....:|..|:....:....|.||:|:|.:..|.:
 Frog    26 NYKSFFAKSGLSSKSADDVKKVFAILDQDKSGFIEE 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeodomain 125..181 CDD:459649
rax2XP_002941436.1 Homeodomain 37..93 CDD:459649 6/25 (24%)
OAR 200..216 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.