DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and dlx4

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:XP_002935758.3 Gene:dlx4 / 100494171 XenbaseID:XB-GENE-876742 Length:253 Species:Xenopus tropicalis


Alignment Length:317 Identity:106/317 - (33%)
Similarity:135/317 - (42%) Gaps:118/317 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SVTPGINIPGKSAFVEL---------QQHAAA---G----YGGIRSTYQH-FGPQGGQDSGFPS- 67
            |:...:..|.||||:|.         .||:.|   |    :|.:.:.::. |.|      |.|| 
 Frog     3 SIADSLLDPSKSAFLEFSHGPTSSPQSQHSPALAHGHYPLHGFLPTAHEGLFSP------GTPSF 61

  Fly    68 PRSALGYPF-PPMHQNSYSGYHLGS-------YAPPCASPPK----DDFSISDKCEDSGLRVNGK 120
            ....|.||: ...|.:....:|.||       |.....|..:    .:...|...|:..:|:|||
 Frog    62 GGRTLPYPYASSSHHHQQQHHHNGSAYLNYQQYTSTIGSSARLHEDQEMEKSTVIENGEIRINGK 126

  Fly   121 GKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKA 185
            |||:|||||||||||||.||:|||:||||||||||||||.||||||||||||||:||||||:|| 
 Frog   127 GKKIRKPRTIYSSLQLQALNQRFQQTQYLALPERAELAAQLGLTQTQVKIWFQNKRSKYKKVMK- 190

  Fly   186 AQGPGTNSGMPLGGGGPNPGQHSPNQMHSGELANGRFLWAALETNGTLALVHSTGGNNGGGSNSG 250
                                       |...:                             .:..
 Frog   191 ---------------------------HGSSV-----------------------------QDED 199

  Fly   251 SPSHYLPPGHSPTPSSTPVSELSPEFPP------TGLSPPTQ-------APWDQKPH 294
            .|:           ||:.::..||..||      ||.|.|..       :||.| ||
 Frog   200 QPA-----------SSSALTPCSPNMPPLWDIPSTGKSAPLSCNYLNSFSPWYQ-PH 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 47/52 (90%)
dlx4XP_002935758.3 COG5576 98..239 CDD:227863 76/208 (37%)
Homeobox 133..187 CDD:395001 48/53 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 109 1.000 Domainoid score I6276
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4306
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416398at2759
OrthoFinder 1 1.000 - - FOG0000655
OrthoInspector 1 1.000 - - otm47671
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X884
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.