DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and nkx6-3

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:XP_002932753.1 Gene:nkx6-3 / 100489301 XenbaseID:XB-GENE-478609 Length:255 Species:Xenopus tropicalis


Alignment Length:220 Identity:58/220 - (26%)
Similarity:90/220 - (40%) Gaps:54/220 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GINIPGKSAFVELQQ-----HAAAGYGGIRSTYQHFGPQGGQDSGFPSPRSALGYPFPPMHQNSY 84
            |...|..:.|.:|..     |..:|           .|.|..|        .|..|.|..|...:
 Frog    22 GCQFPAHTPFHKLNPSVLGCHLPSG-----------TPHGISD--------ILSRPLPASHSGMF 67

  Fly    85 SGY----HLGSYAPP------------------------CASPPKDDFSISDKCEDSGLRVNGKG 121
            .||    ..||.:.|                        |.:..:.|:...::...|.....|..
 Frog    68 PGYPTVQGYGSSSVPGSCYGEQGSILTKSGTPYTNQSRGCWTDIEQDWRGGNRALSSVSNTEGSS 132

  Fly   122 KKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKAA 186
            :| :..|..::..|:..|.:.|::|:|||.||||.||.|||::::|||:||||||:|::| ..|.
 Frog   133 RK-KHTRPTFTGHQIFALEKTFEQTKYLAGPERARLAFSLGMSESQVKVWFQNRRTKWRK-KSAV 195

  Fly   187 QGPGTNSGMPLGGGGPNPGQHSPNQ 211
            :.||..|....|.|...|.::..::
 Frog   196 ETPGLPSLSTRGPGDLTPSENEDDE 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 27/52 (52%)
nkx6-3XP_002932753.1 Homeobox 137..190 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.