DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dll and dlx1

DIOPT Version :9

Sequence 1:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001093727.1 Gene:dlx1 / 100101750 XenbaseID:XB-GENE-876850 Length:251 Species:Xenopus tropicalis


Alignment Length:289 Identity:111/289 - (38%)
Similarity:137/289 - (47%) Gaps:90/289 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TAASVTPGINIP--GKSAFVELQQHAAAGYGGIRSTYQHFGPQGGQDSGFPSPRS---------- 70
            |..|:...::.|  ||:.|:|                  |||...|..  |||.|          
 Frog     2 TMTSMPESLSSPVSGKAVFME------------------FGPPNQQMP--PSPMSHGHYSMHCLH 46

  Fly    71 ---------------ALGYPFPPMHQNSYSGYHLGSYAPPCASPPKDDFSISDKCEDSG------ 114
                           |||||:    .||.|.:....|.....|.|........:.|:.|      
 Frog    47 SQHDSSYSGASSFSRALGYPY----VNSVSSHSSNPYISTVQSYPNSSSLSQTRLEEPGAETEKS 107

  Fly   115 -------LRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWF 172
                   :|.||||||:|||||||||||||.||||||:|||||||||||||||||||||||||||
 Frog   108 TVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWF 172

  Fly   173 QNRRSKYKKMMKAAQGPGTNSGMPLGGGGPNPGQHSPNQMHSGELANGRFLWAALETNGTLALVH 237
            ||:|||:||:||.            ||..          :.|..|||||.|   ..::.::|.|.
 Frog   173 QNKRSKFKKLMKQ------------GGAA----------LESSALANGRSL---SSSSPSVAPVW 212

  Fly   238 STGGNNGGGSNSGSPSHYLPPGHSPTPSS 266
            :| ....|.::||:|..|:|...|..||:
 Frog   213 NT-NTPSGKTSSGTPGAYIPSYTSWYPSA 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DllNP_001137759.1 Homeobox 127..180 CDD:278475 49/52 (94%)
dlx1NP_001093727.1 Homeobox 127..181 CDD:365835 49/53 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 109 1.000 Domainoid score I6276
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4306
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416398at2759
OrthoFinder 1 1.000 - - FOG0000655
OrthoInspector 1 1.000 - - otm47671
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X884
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.