DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3611 and CG34106

DIOPT Version :9

Sequence 1:NP_001286858.1 Gene:CG3611 / 37972 FlyBaseID:FBgn0035069 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001036365.1 Gene:CG34106 / 4379891 FlyBaseID:FBgn0083942 Length:122 Species:Drosophila melanogaster


Alignment Length:114 Identity:34/114 - (29%)
Similarity:56/114 - (49%) Gaps:0/114 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVTTEQLRYQLAFSHAMERTTRHWQETFAWYPKMQCCHYQRIDQIYLTSRQRYGDGHFLKYANRR 69
            ::.|.:|.:.......:|.|.|||:|..:|:|..|.....|..:||..|.::||:.::..||||.
  Fly     5 VIFTAELLHHRTVGSQIEETRRHWEERCSWFPAAQRNMASRCSEIYKESLEKYGNDYYEFYANRN 69

  Fly    70 RLAKKFVVTAQEVAEGLEDLKMLEQDGITGLKVAVTENGEYGRMKPSKL 118
            ||.::..|..:..............|.:...:|:.|.|||||.::|..|
  Fly    70 RLKEEHRVNTKSYKRRERRRSHRPMDHLKDYRVSPTSNGEYGSVRPMLL 118



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468946
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016627
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.