DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12849 and CG14518

DIOPT Version :9

Sequence 1:NP_611969.2 Gene:CG12849 / 37971 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:159 Identity:45/159 - (28%)
Similarity:77/159 - (48%) Gaps:21/159 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FEFNNVVCLVRDRMFMDFEYCYLKSVNRTYKYLSLKTKMFRLPVDNCETRFQLRMREN--RRVLY 83
            |:..|.||...::.:::|..|.|::|:|....|::...:.. ||.:...:.:|..|.|  :..||
  Fly    25 FKMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLH-PVHDVIVKARLLKRANGYKPWLY 88

  Fly    84 NFDFKVDSCKFMRDRKHVIANWVYQTFGPYSNLNHTCPY-------DHDIVLDKLPVQHLNKLVQ 141
            :..|  |.|:|:|.|.:.:...|::.|..||.:||||||       :..:..:|||..       
  Fly    89 SVSF--DGCQFIRRRNNALIRIVWELFKEYSTINHTCPYVGLQQVKNFYLRSEKLPTP------- 144

  Fly   142 SIIPDGRYMMNSTWMVAGIPRTDVILYFT 170
              ||.|.|::...|:....|:....:|||
  Fly   145 --IPTGEYLLMIDWVFNKKPQAATNVYFT 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12849NP_611969.2 DM8 80..172 CDD:214778 30/98 (31%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 30/100 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472608
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.840

Return to query results.
Submit another query.