DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12849 and CG14456

DIOPT Version :9

Sequence 1:NP_611969.2 Gene:CG12849 / 37971 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster


Alignment Length:133 Identity:23/133 - (17%)
Similarity:53/133 - (39%) Gaps:27/133 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DRMFMDFEYCYLKSVNRTYKYLSLKTKMFRLPVDNCETRFQLRMRENRRVLYNFDFK--VDSCKF 94
            |..|:..:..|    :.:..:|:...::.: .:.:.:...::|:...:...||.:..  ::.|:.
  Fly    37 DEKFVSHKVVY----DNSDPHLNFSMEVHQ-ELHDVDIHVEVRITNKQDPYYNTNLNTTLNVCRI 96

  Fly    95 MR-DRKHVIANWVYQTFGPYSNLNHTCP------YDHDIVLDKLPVQHLNKLVQSIIPDGRYMMN 152
            :. ..|..:..:|:.....:.|:..|||      :.|.|        ||.:.:|     |.|.:|
  Fly    97 LGFANKSPVGRFVHGFIREFGNIVETCPIAKGRYHWHRI--------HLKRKLQ-----GSYFIN 148

  Fly   153 STW 155
            ..|
  Fly   149 KFW 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12849NP_611969.2 DM8 80..172 CDD:214778 18/85 (21%)
CG14456NP_001137998.1 DM8 82..189 CDD:214778 18/83 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448135
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.