DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12849 and CG33757

DIOPT Version :9

Sequence 1:NP_611969.2 Gene:CG12849 / 37971 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001027398.1 Gene:CG33757 / 3772602 FlyBaseID:FBgn0053757 Length:178 Species:Drosophila melanogaster


Alignment Length:156 Identity:44/156 - (28%)
Similarity:78/156 - (50%) Gaps:10/156 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FLLIFMSPMAIRGHFEFNNVVCLVRDRMFMDFEYCYLKSVNRTYKYLSLKTKMFRLPVDNCETRF 71
            |:|:.::|:.:..  :|.::.|...||.:.:...|.:|::||....:|::.:..| .|:|...|.
  Fly     8 FVLVLLTPLQLEA--KFKSLHCTNYDRSYGEILLCKIKAINRYRNSISIQFRQLR-TVNNVHMRL 69

  Fly    72 QLRMREN--RRVLYNFDFKVDSCKFMRDRKHVIANWVYQTFGPYSNL-NHTCPY--DHDIVLDKL 131
            :|..|.|  |..|||..|.:  |.|:..|.:||.:..|:...||..: |:|||:  :|.|....|
  Fly    70 ELFKRANGWRPFLYNISFNL--CDFLSKRNNVIVSLGYEYLKPYIPMTNYTCPFKKNHLIKCTDL 132

  Fly   132 PVQHLNKLVQSIIPDGRYMMNSTWMV 157
            ........|:..|..|.|.:..:::|
  Fly   133 EFDIEKFRVRFPIETGEYALQLSFIV 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12849NP_611969.2 DM8 80..172 CDD:214778 24/81 (30%)
CG33757NP_001027398.1 DUF1091 67..152 CDD:284008 28/86 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.