DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12849 and CG33757

DIOPT Version :10

Sequence 1:NP_611969.2 Gene:CG12849 / 37971 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001027398.1 Gene:CG33757 / 3772602 FlyBaseID:FBgn0053757 Length:178 Species:Drosophila melanogaster


Alignment Length:156 Identity:44/156 - (28%)
Similarity:78/156 - (50%) Gaps:10/156 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FLLIFMSPMAIRGHFEFNNVVCLVRDRMFMDFEYCYLKSVNRTYKYLSLKTKMFRLPVDNCETRF 71
            |:|:.::|:.:..  :|.::.|...||.:.:...|.:|::||....:|::.:..| .|:|...|.
  Fly     8 FVLVLLTPLQLEA--KFKSLHCTNYDRSYGEILLCKIKAINRYRNSISIQFRQLR-TVNNVHMRL 69

  Fly    72 QLRMREN--RRVLYNFDFKVDSCKFMRDRKHVIANWVYQTFGPYSNL-NHTCPY--DHDIVLDKL 131
            :|..|.|  |..|||..|.:  |.|:..|.:||.:..|:...||..: |:|||:  :|.|....|
  Fly    70 ELFKRANGWRPFLYNISFNL--CDFLSKRNNVIVSLGYEYLKPYIPMTNYTCPFKKNHLIKCTDL 132

  Fly   132 PVQHLNKLVQSIIPDGRYMMNSTWMV 157
            ........|:..|..|.|.:..:::|
  Fly   133 EFDIEKFRVRFPIETGEYALQLSFIV 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12849NP_611969.2 DM8 80..172 CDD:214778 24/81 (30%)
CG33757NP_001027398.1 DUF1091 67..152 CDD:461928 28/86 (33%)

Return to query results.
Submit another query.