DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12849 and CG33690

DIOPT Version :9

Sequence 1:NP_611969.2 Gene:CG12849 / 37971 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001368948.1 Gene:CG33690 / 3772513 FlyBaseID:FBgn0053690 Length:176 Species:Drosophila melanogaster


Alignment Length:164 Identity:60/164 - (36%)
Similarity:92/164 - (56%) Gaps:4/164 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FLLIFMSPMAIRGHFEFNNVVCLVRDRMFMDFEYCYLKSVNRTYKYLSLKTKMFRLPVDNCETRF 71
            |||..  ||....|..|.|:.|...:..||.|..|.:|:||||:||:|:..|:.::|:.:.....
  Fly     9 FLLTL--PMICFCHVTFTNLNCSSYNLDFMSFPTCRIKAVNRTHKYISIYAKLNQVPIVDARVTI 71

  Fly    72 QLRMRENRRVLYNFDFKVDSCKFMRDRKHVIANWVYQTFGPYSNLNHTCPYDHDIVLDKLPVQHL 136
            |.|..::....:.:|...|.||||:.:|:|:....|:||...:|:|||||||||:::|||...:|
  Fly    72 QFRRFDSGYKPFLYDLSYDGCKFMKTQKNVLVKTFYRTFQRNTNINHTCPYDHDLIVDKLFTGNL 136

  Fly   137 NKLVQS--IIPDGRYMMNSTWMVAGIPRTDVILY 168
            .:....  |||:|.|.:.:.|....|.|..|.:|
  Fly   137 EEEFGRFIIIPNGDYAIYTDWATNKISRASVKIY 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12849NP_611969.2 DM8 80..172 CDD:214778 35/91 (38%)
CG33690NP_001368948.1 DUF1091 73..153 CDD:399471 31/79 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472116
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.940

Return to query results.
Submit another query.