DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12849 and CG33792

DIOPT Version :10

Sequence 1:NP_611969.2 Gene:CG12849 / 37971 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster


Alignment Length:186 Identity:35/186 - (18%)
Similarity:69/186 - (37%) Gaps:50/186 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FEFNNVVCLVRDRMFMDFEYCYLKSVNRTYKYLS-------------LKTKMFRLPVDNCETRFQ 72
            |:.....|:.....|.:.. |.||.||.|...|:             :..::|.....|....|.
  Fly    31 FKIRKTECIANGAYFSNVS-CILKPVNWTRSVLNMDGDIKEALTDIKMSVEVFYKDSSNLYKPFA 94

  Fly    73 LRMRENRRVLYNFDFKVDSCKFMRDR--KHVIANWVYQTFGPYSNLNHTCPYD-----HDIVLDK 130
            ::            ||.|.|:.::::  .:.:..:.......::|:||:|||.     ::||...
  Fly    95 VK------------FKFDVCQLLKNKTQSNFLQKYAISHLTEWTNVNHSCPYRVSLCIYNIVKFS 147

  Fly   131 LPVQH---------------LNKLVQSIIP--DGRYMMNSTWMVAGIPRTDVILYF 169
            ..:::               |:::...|:|  |.:...|.:....||....|::||
  Fly   148 QYIEYIYMFLKGHLIARNFRLDEVSLPILPIQDYKIAFNFSGANPGIHLGLVLIYF 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12849NP_611969.2 DM8 80..172 CDD:214778 22/114 (19%)
CG33792NP_001027411.2 DUF1091 82..183 CDD:461928 19/112 (17%)

Return to query results.
Submit another query.