DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12849 and CG33647

DIOPT Version :9

Sequence 1:NP_611969.2 Gene:CG12849 / 37971 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001027136.1 Gene:CG33647 / 3772049 FlyBaseID:FBgn0053647 Length:190 Species:Drosophila melanogaster


Alignment Length:87 Identity:21/87 - (24%)
Similarity:32/87 - (36%) Gaps:28/87 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AIRGHFEFNNVVCLVRDRMFMDFEYCYLKSVNRTY-----------------------KYLSLK- 56
            ::..||.|..|...:|:......: |.||...|.|                       .:||:| 
  Fly   103 SVENHFLFRMVTTQLRETANFPIQ-CPLKMNKRYYAKGFTVNSKFIPSYMPETNFISDAHLSVKD 166

  Fly    57 TKMFRLPVDNCETRFQLRMREN 78
            .|:|||.:   :.||...:|.|
  Fly   167 RKVFRLLI---KGRFSRILRRN 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12849NP_611969.2 DM8 80..172 CDD:214778
CG33647NP_001027136.1 DUF1091 <95..156 CDD:284008 10/53 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.