DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12849 and CG33641

DIOPT Version :9

Sequence 1:NP_611969.2 Gene:CG12849 / 37971 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001027256.1 Gene:CG33641 / 3771970 FlyBaseID:FBgn0053641 Length:181 Species:Drosophila melanogaster


Alignment Length:111 Identity:30/111 - (27%)
Similarity:50/111 - (45%) Gaps:24/111 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RDRMFMD-----------FEY--CYL-KSVNRTYKYLSLKTKMFRLPVDNCETR----FQLRMRE 77
            |.|:|.|           ||.  |.| ::.||:|..:.:|.|.   .|.:...|    |.....:
  Fly    23 RLRIFFDEFAIKYKVPDIFEKMDCNLYQANNRSYVNVEMKLKK---EVSDLNVRAIMEFWKPNAQ 84

  Fly    78 NRRVLYNFDFKVDSCKFMRD-RKHVIANWVYQTFGPYSNLNHTCPY 122
            |:..||  |.:||.|..:|. .|:.:..:..::|..:||:..:||:
  Fly    85 NKMKLY--DVRVDGCLILRTIHKNKLFYFYVKSFKKHSNVVLSCPF 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12849NP_611969.2 DM8 80..172 CDD:214778 13/44 (30%)
CG33641NP_001027256.1 DUF1091 80..156 CDD:284008 14/51 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.