DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12849 and CG33768

DIOPT Version :9

Sequence 1:NP_611969.2 Gene:CG12849 / 37971 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001027142.2 Gene:CG33768 / 3771840 FlyBaseID:FBgn0053768 Length:175 Species:Drosophila melanogaster


Alignment Length:177 Identity:38/177 - (21%)
Similarity:64/177 - (36%) Gaps:44/177 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLIFMSPMAIRGHFEFNNVVCLVRDRMFMDFEYCYLKSVNRT-YKYLSLKTKM---FRLPVDNCE 68
            ::||:| .|:......|.|.|....:.|....   :.|||.| |..:.|...:   ||..||   
  Fly     9 MVIFVS-QAVSSSVTLNRVQCEKNAKFFATLN---VTSVNSTIYADIELLQALKAGFRGHVD--- 66

  Fly    69 TRFQLRMRENRRVLYNFDFKVDSCKFMRDRK-HVIANWVYQTFGPYSNLNHTCPYDHDIVLDKLP 132
              .|||:...::.........|.|:.:...| .:...|: ::....||....||         :|
  Fly    67 --VQLRLSNAKKFQSLVQADTDYCELLSTLKDSLFRRWI-KSVSKNSNFMENCP---------VP 119

  Fly   133 VQHL--------NKLVQSIIPDGRYMMNSTWMVAGIPRTDVILYFTK 171
            ..|.        ..||.|.:..|.|::::            ::|:.|
  Fly   120 AGHYYLKGWHVEMGLVPSYLLSGDYLLSA------------LVYYGK 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12849NP_611969.2 DM8 80..172 CDD:214778 17/101 (17%)
CG33768NP_001027142.2 DM8 76..167 CDD:214778 17/101 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447975
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.