DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12849 and CG33654

DIOPT Version :10

Sequence 1:NP_611969.2 Gene:CG12849 / 37971 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster


Alignment Length:169 Identity:64/169 - (37%)
Similarity:101/169 - (59%) Gaps:17/169 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLIFMSPMAIRGHFEFNNVVCLVRDRMFMDFEYCYLKSVNRTYKYLSLKTKMFRLPVDNCETRFQ 72
            |:|.:........|||.|:.|...|:.|.||||||::|.||:||||:||..:|:.|         
  Fly    13 LVILLMAKWASSKFEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLTLKVNLFKTP--------- 68

  Fly    73 LRMRENRRVLYNFDFKVDSCKFMR--DRKHVIANWVYQTFGPYSNLNHTCPYDHDIVLDKLPVQH 135
               |.|....:.|:..:|:|:|::  |.| .||.:.|:.|..||||||:||::||:::||:|:..
  Fly    69 ---RFNGYRPFMFNITLDACRFLKNTDSK-PIAKYFYEFFNSYSNLNHSCPFNHDLIVDKIPIDF 129

  Fly   136 LNKLVQSII--PDGRYMMNSTWMVAGIPRTDVILYFTKS 172
            :|..|.:|:  |:|.|::.:.|:...|.|..|.:|:|.|
  Fly   130 VNHRVTNILPFPEGDYLLETHWIAYEIDRAMVKIYYTIS 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12849NP_611969.2 DM8 80..172 CDD:214778 35/95 (37%)
CG33654NP_001027165.1 DUF1091 60..147 CDD:461928 35/99 (35%)

Return to query results.
Submit another query.