DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12849 and CG33467

DIOPT Version :9

Sequence 1:NP_611969.2 Gene:CG12849 / 37971 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster


Alignment Length:170 Identity:37/170 - (21%)
Similarity:68/170 - (40%) Gaps:33/170 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WTFLLIFMSPMAIRGH-------FEFNNVVCLVRDRMFMDFEYCYLKSVNRTYKYLSLKTKMFRL 62
            |..||    .:...||       ::|..|.|........:.. |.:|.:|.....::|...:. .
  Fly     5 WLVLL----SICFIGHMTDSQLVYKFTKVECQGNQARVKNVS-CNVKPINWNTALVNLDCYLI-Y 63

  Fly    63 PVDNCETRFQLRMRE--NRRVLYNFDFKVDSCKFMRDRKHVI--ANWVYQTFGPYSNLNHTCPYD 123
            |:.|...|.|:.|::  |:...:..|.....|..: :||:.:  |..|::.|..::|:. :|   
  Fly    64 PLINPTIRVQVFMKDYSNQYKPFLIDATFKLCDVV-ERKNFLPYAVMVWELFQRFTNVK-SC--- 123

  Fly   124 HDIVLDKLPVQ--HLNKLVQSIIPDGRYMM-------NST 154
            |  :..:|..:  :||.......|.|:|.:       |||
  Fly   124 H--ISGQLSARNGYLNSSYVPPFPHGQYQISVMFSDSNST 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12849NP_611969.2 DM8 80..172 CDD:214778 19/86 (22%)
CG33467NP_001286440.1 DUF1091 70..151 CDD:284008 20/87 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472601
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.