DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment key and IKBKG

DIOPT Version :9

Sequence 1:NP_001246503.1 Gene:key / 37967 FlyBaseID:FBgn0041205 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001093326.2 Gene:IKBKG / 8517 HGNCID:5961 Length:487 Species:Homo sapiens


Alignment Length:398 Identity:93/398 - (23%)
Similarity:141/398 - (35%) Gaps:130/398 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 LCSLQGSAEEVVKLQNMMTEYLALKSTLDKVNQTM------------------------------ 135
            |.|.||:.|   .||..:.|...|:..:.:.||.:                              
Human   109 LPSEQGAPE---TLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARK 170

  Fly   136 ----LNYHNLTQQWRQEAADREHQYKEHVKECQ-----------AQIAILRVENQELKRDLETKI 185
                |....|..:.::|.|.||   .||:|.||           ||:..|..|.||.:..||...
Human   171 LVERLGLEKLDLKRQKEQALRE---VEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAT 232

  Fly   186 EQIEGVHTIRLKEQDELRKSVSEKQSLIDNMRVEIDKLKQLNHSFEFVPEYATESKSQELIKKMQ 250
            ::.:.:........::.|:..||:::|.....|::|:|:....|.|.......::.|:|..|..|
Human   233 KECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQ 297

  Fly   251 LDI----------NELKA--------RDIQ-----------------KQEVIKG----------- 269
            |.:          |.:|:        |.:|                 |||||..           
Human   298 LQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIV 362

  Fly   270 ------LQIQNDIYRRDFEMERADREKNAGEKDQYLMDLRSLQRRNQELIEALAESHKASKACST 328
                  |:.|.|||:.||:.||..|||.|.:|:.....|..|||...:|        |||  |..
Human   363 METVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKL--------KAS--CQE 417

  Fly   329 ASPLSSSRS-NLREEQRPVRILDPTGA---------SSRTS----DTTLRCPICSKSFNALSVLQ 379
            ::.:...|. ::...|.|   |.|..|         |.|.|    .....||.|......:..||
Human   418 SARIEDMRKRHVEVSQAP---LPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQ 479

  Fly   380 SHVNDCLD 387
            .||.:|::
Human   480 IHVMECIE 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
keyNP_001246503.1 DUF499 <168..>351 CDD:303008 56/235 (24%)
UBAN 230..313 CDD:197361 33/134 (25%)
IKBKGNP_001093326.2 NEMO 112..179 CDD:288434 10/69 (14%)
CC2-LZ 327..412 CDD:293124 25/92 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326045at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.