DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment key and Ikbkg

DIOPT Version :9

Sequence 1:NP_001246503.1 Gene:key / 37967 FlyBaseID:FBgn0041205 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_008771822.1 Gene:Ikbkg / 309295 RGDID:735223 Length:431 Species:Rattus norvegicus


Alignment Length:423 Identity:95/423 - (22%)
Similarity:156/423 - (36%) Gaps:132/423 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 GSSQQQSLATSFIMGEIQSDVLKNSVYSQFPSLCSLQGSAEEVVKLQNMMTEYLALKSTLDKVNQ 133
            |.::.|.:     :|| :|.:.|.::.    .|.|.||:.|   .||..:.|...|:..:.:.||
  Rat    37 GPAEDQDM-----LGE-ESSLGKPAML----HLPSEQGTPE---TLQRCLEENQELRDAIRQSNQ 88

  Fly   134 -------TMLNY------------------HNLTQQWRQEAADREHQYK------EHVKECQ--- 164
                   .:|::                  ..|.::...|..|...|.:      ||:|:||   
  Rat    89 MLRERCEELLHFQVSQREEKEFLMCKFQEARKLVERLSLEKLDLRRQREQALEDLEHLKKCQQVQ 153

  Fly   165 ---------AQIAILRVENQELKRDLE--TKIEQ-IEGVHTIRLKE-QDELRKSVSEKQSLIDNM 216
                     ||:..|..|.||.:..||  ||..| :||    |::. .:::|:..||::.|....
  Rat   154 MAEDKASVKAQVTSLLGELQESQSRLEAATKERQTLEG----RIRAVSEQVRQLESEREVLQQQH 214

  Fly   217 RVEIDKLKQLNHSFEFVPEYATESKSQE------------------------------------- 244
            .|::|:|:..|.|.|.......::.|:|                                     
  Rat   215 SVQVDQLRMQNQSVEAALRMERQAASEEKRKLAQLQAAYHQLFQDYDSHIKSSKGMQLEDLRQQL 279

  Fly   245 ------LIKKMQLDINELKARDIQKQ---EVIKGLQIQNDIYRRDFEMERADREKNAGEKDQYLM 300
                  |:.|.:| |::||....|.:   |.:..|:.|.|||:.||:.||..|||....|:....
  Rat   280 QQAEEALVAKQEL-IDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERHAREKLVERKELLQE 343

  Fly   301 DLRSLQRRNQELIEALAESHKASKACSTASPLSSSRSNLREEQRPVRILDPTGASSRTSDTTLR- 364
            .|..|||          |.:|....|..::.:...|....|..:|..:..|...|...:.:..| 
  Rat   344 QLEQLQR----------EFNKLKVGCHESARIEDMRKRHVETSQPPLLPAPAHHSFHLALSNQRR 398

  Fly   365 ----------CPICSKSFNALSVLQSHVNDCLD 387
                      ||.|......:..||.||.:|::
  Rat   399 SPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
keyNP_001246503.1 DUF499 <168..>351 CDD:303008 55/232 (24%)
UBAN 230..313 CDD:197361 28/128 (22%)
IkbkgXP_008771822.1 NEMO 62..129 CDD:288434 11/69 (16%)
MIT_CorA-like <189..>299 CDD:294313 21/114 (18%)
UBAN 270..356 CDD:197361 27/96 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326045at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.