DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment key and ikbkg

DIOPT Version :9

Sequence 1:NP_001246503.1 Gene:key / 37967 FlyBaseID:FBgn0041205 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_012816058.1 Gene:ikbkg / 100145270 XenbaseID:XB-GENE-979184 Length:553 Species:Xenopus tropicalis


Alignment Length:446 Identity:99/446 - (22%)
Similarity:164/446 - (36%) Gaps:113/446 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DEESFVILGSSPCSSLMPDSSLRSDVCGNAQEAKETVASTSTQPPTVNCIPVSITASQQQHK--- 64
            :|:.:    ::|.|||....:|...:|       ||:..|         :|.....|:.:.|   
 Frog   158 EEQDY----ATPGSSLSSCETLTHSIC-------ETIRQT---------VPDEEGPSRNKQKENG 202

  Fly    65 --------SLDSGSSQQQSLATSFIMGEIQSDVLKNSVYSQFPSLCSLQGSAEEVVKLQNMMTEY 121
                    .:..|:..:.|........::|....:|:.:.:  .:..||   |||.||:..:.| 
 Frog   203 NKEVCMENEIMQGTVDRNSRTEQEFQKKLQDAEARNTQFLR--QIADLQ---EEVSKLRRQVVE- 261

  Fly   122 LALKSTLDKVNQTMLNYHNLTQQWRQEAADREHQYKEHV-------KECQAQIAILRVENQELKR 179
                    |..::.....:|..|..|.:.:| :..|..|       ||.|..:.|...|.::::.
 Frog   262 --------KGEESQKQLQSLQLQMEQLSEER-NSVKAQVTSLLGELKESQTSLEICLQEKRKVED 317

  Fly   180 DLETKIEQIEGVHTIRLKEQ----DELRKSVS--------EKQSLIDNMRVEIDKLKQLNHSFE- 231
            .|.:.:|:.:|... ::|:|    |:....|.        |:|:..|..|    ||.||..::. 
 Frog   318 SLRSALEEKKGWEA-QVKQQVVQLDQRMMQVQNLETALKMERQNATDEKR----KLAQLQVAYHT 377

  Fly   232 FVPEYATESK----SQELIKKMQLDINELKAR--------------------DIQKQ----EVIK 268
            ...||.|..|    ..:..|.:.|.|.|||.:                    :.:||    :.:.
 Frog   378 LFQEYDTHIKVSMQQAKHTKGVDLQIQELKQQLQEAEEALVAKQALIDKLKDEAEKQRTELDTVP 442

  Fly   269 GLQIQNDIYRRDFEMERADREKNAGEKDQYLMDLR-SLQRR--NQELIEALAESHKASKACSTAS 330
            .|:.|.:|||.||..||..||:...||::....|. .||.|  |:.:|:.:...|.     .|..
 Frog   443 VLKAQVEIYRADFLAERKAREELHAEKERLQEQLNVLLQERLSNRAMIDEMRNRHS-----DTLR 502

  Fly   331 PLSSSRSNLREEQRPVRILDPTGASSRTSDTTLRCPICSKSFNALSVLQSHVNDCL 386
            |......:|...| |.....|     ........||.|......:..||.||.||:
 Frog   503 PTLPHGPSLYPLQ-PAMPFQP-----EVEPPDFSCPKCFYKAPDMDTLQIHVMDCI 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
keyNP_001246503.1 DUF499 <168..>351 CDD:303008 54/226 (24%)
UBAN 230..313 CDD:197361 30/114 (26%)
ikbkgXP_012816058.1 NEMO 42..108 CDD:371612
SMC_prok_B 82..>371 CDD:274008 50/252 (20%)
SMC_prok_A 229..>500 CDD:274009 69/295 (23%)
UBAN 402..483 CDD:197361 22/80 (28%)
zf_C2H2_10 527..552 CDD:375840 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5214
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326045at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.