powered by:
Protein Alignment CG3589 and NAS2
DIOPT Version :9
Sequence 1: | NP_611968.1 |
Gene: | CG3589 / 37966 |
FlyBaseID: | FBgn0035065 |
Length: | 509 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_012259.3 |
Gene: | NAS2 / 854810 |
SGDID: | S000001269 |
Length: | 220 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 51 |
Identity: | 12/51 - (23%) |
Similarity: | 23/51 - (45%) |
Gaps: | 12/51 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 LKIRHALLEVTSPPAAKQS------AIIINNE------LIISSGSILQPHL 41
:|:...|:.:.:..||..| .:::.|| |::..|.||:..|
Yeast 151 IKVDDKLISIGNVHAANHSKLQNIQMVVMKNEDRPLPVLLLREGQILKTSL 201
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0265 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.