DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG3589 and NAS2

DIOPT Version :9

Sequence 1:	NP_611968.1	Gene:	CG3589 / 37966	FlyBaseID:	FBgn0035065	Length:	509	Species:	Drosophila melanogaster
Sequence 2:	NP_012259.3	Gene:	NAS2 / 854810	SGDID:	S000001269	Length:	220	Species:	Saccharomyces cerevisiae

Alignment Length:	51	Identity:	12/51 - (23%)
Similarity:	23/51 - (45%)	Gaps:	12/51 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly     3 LKIRHALLEVTSPPAAKQS------AIIINNE------LIISSGSILQPHL 41
            :|:...|:.:.:..||..|      .:::.||      |::..|.||:..|
Yeast   151 IKVDDKLISIGNVHAANHSKLQNIQMVVMKNEDRPLPVLLLREGQILKTSL 201

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG3589	NP_611968.1	Trypsin	296..471	CDD:278516
CG3589	NP_611968.1	Trypsin_2	305..445	CDD:290102
NAS2	NP_012259.3	Nas2_N	31..109	CDD:408080
NAS2	NP_012259.3	PDZ	106..182	CDD:395476	5/30 (17%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0265
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900