DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3589 and AT3G03370

DIOPT Version :10

Sequence 1:NP_611968.1 Gene:CG3589 / 37966 FlyBaseID:FBgn0035065 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_186987.2 Gene:AT3G03370 / 821271 AraportID:AT3G03370 Length:198 Species:Arabidopsis thaliana


Alignment Length:132 Identity:25/132 - (18%)
Similarity:52/132 - (39%) Gaps:20/132 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 HIANYLRYLQPMHTLDDVLVMCSPFGLENFYKTISIGKVSN--VMGRSGCLFAISNALPLGCEGS 229
            |:.:::.|.:|:....:|||.....||..........||:|  :.| .|.|.::.:.|..|..  
plant     6 HLEDFVCYTEPLDDNIEVLVPDDDHGLYAIDILDPSWKVANEDISG-LGDLVSVLSKLSRGAR-- 67

  Fly   230 AVFNNKLRLVGIVICTSFQRHHENVNLTLAANFGYLLRNFMEQLGMSTTAF------QLSREPSS 288
                     |.:...:...||.:.:...:.:.:.:::........:|..:|      :|..|.|:
plant    68 ---------VPLEYMSHTDRHRKKLRTLMDSTYKFVVAQLHTFSSLSLDSFCGISPERLLCERST 123

  Fly   289 FA 290
            |:
plant   124 FS 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3589NP_611968.1 Trypsin_2 305..445 CDD:433149
AT3G03370NP_186987.2 alpha/beta hydrolases 13..>61 CDD:473884 13/48 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.