DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3589 and Htra3

DIOPT Version :9

Sequence 1:NP_611968.1 Gene:CG3589 / 37966 FlyBaseID:FBgn0035065 Length:509 Species:Drosophila melanogaster
Sequence 2:XP_006504249.1 Gene:Htra3 / 78558 MGIID:1925808 Length:467 Species:Mus musculus


Alignment Length:180 Identity:44/180 - (24%)
Similarity:74/180 - (41%) Gaps:42/180 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 ILTCAHVVGQN----------IETVNCRAADREFQSEVIWCNPDSDKPFDLA-LLTAPQDVPEQC 371
            |:|.||||..:          ::..|..|.:...|        |.||..|:| ::..|:   ::.
Mouse   192 IVTNAHVVSSSSTASGRQQLKVQLQNGDAYEATIQ--------DIDKKSDIATIVIHPK---KKL 245

  Fly   372 CVRLARSPATV--GQMVYNAGFPYYVNFSFRHDFNPSIF-----QGRVI---KCDTGAIMSDGSV 426
            .|.|....|.:  |:.|...|.|    |:.::.....|.     .|:.:   ..|...|.:|..:
Mouse   246 PVLLLGHSADLRPGEFVVAIGSP----FALQNTVTTGIVSTAQRDGKELGLRDSDMDYIQTDAII 306

  Fly   427 QAGQSGGPMFDQNGCILGVCVSNIKLDDVVYPNINTAIPICDIRNTLQQF 476
            ..|.||||:.:.:|.::|  ::.:|    |...|:.|||...|...|.:|
Mouse   307 NYGNSGGPLVNLDGEVIG--INTLK----VAAGISFAIPSDRITRFLSEF 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3589NP_611968.1 Trypsin 296..471 CDD:278516 42/173 (24%)
Trypsin_2 305..445 CDD:290102 34/147 (23%)
Htra3XP_006504249.1 IGFBP 31..82 CDD:365955
Kazal_2 <95..132 CDD:369449
degP_htrA_DO 149..>440 CDD:273938 44/180 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.