DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3589 and htra1

DIOPT Version :9

Sequence 1:NP_611968.1 Gene:CG3589 / 37966 FlyBaseID:FBgn0035065 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001072730.2 Gene:htra1 / 780187 XenbaseID:XB-GENE-487699 Length:460 Species:Xenopus tropicalis


Alignment Length:188 Identity:52/188 - (27%)
Similarity:80/188 - (42%) Gaps:30/188 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 ESAGQQGTGTFIRVHNKRFILTCAHVVGQNIETVNCRAADREFQSEVIWCNPDSDKPFDLAL--L 361
            |.....|:| || |.....|||.||||.........|:....:.:::|    |.|:..|:||  :
 Frog   177 EVPAASGSG-FI-VSEDGLILTNAHVVTNKHRLKVERSDGSTYDAQII----DVDEKADIALIKI 235

  Fly   362 TAPQDVPEQCCVRLARS-PATVGQMVYNAGFPYYVNFSFRHDFNPSIFQ-----GRVI---KCDT 417
            .|...:|   .:.|.|| ....|:.|...|.|    ||.::.....|..     |:.:   ..|.
 Frog   236 KAKGKLP---VLLLGRSEDLRPGEFVVAIGSP----FSLQNTVTTGIVSTAQRGGKELGLRNSDM 293

  Fly   418 GAIMSDGSVQAGQSGGPMFDQNGCILGVCVSNIKLDDVVYPNINTAIPICDIRNTLQQ 475
            ..|.:|..:..|.||||:.:.:|.::|  ::.:|    |...|:.|||...||..|.:
 Frog   294 DYIQTDAIINYGNSGGPLVNLDGEVIG--INTLK----VTAGISFAIPSDKIRKFLAE 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3589NP_611968.1 Trypsin 296..471 CDD:278516 50/182 (27%)
Trypsin_2 305..445 CDD:290102 41/150 (27%)
htra1NP_001072730.2 IGFBP 26..80 CDD:365955
KAZAL 89..>115 CDD:197624
degP_htrA_DO 151..>459 CDD:273938 52/188 (28%)
Serine protease 183..343 50/178 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.