DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3589 and Psmd9

DIOPT Version :9

Sequence 1:NP_611968.1 Gene:CG3589 / 37966 FlyBaseID:FBgn0035065 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_080276.2 Gene:Psmd9 / 67151 MGIID:1914401 Length:222 Species:Mus musculus


Alignment Length:204 Identity:42/204 - (20%)
Similarity:69/204 - (33%) Gaps:63/204 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LKIRHALLEVTSPPAAKQSAIIINNELIISSGSILQPHLAVDGDKGAQNKAIVARLQRGQLLDVQ 67
            :|..:.:||       .|..|.:|..|:...|   .|...||        ....|..|..::.:|
Mouse    37 IKANYDVLE-------SQKGIGMNEPLVDCEG---YPRADVD--------LYQVRTARHNIICLQ 83

  Fly    68 NEEQEEDAQI-RSLHFVATFDPQQRRPRPIAAPGSRQPHILSRFTAHPLYVFCANEVCRNLHHIL 131
            |:.:....|: .:||.:...| ::::.|.:|.                     |.|...|..   
Mouse    84 NDHKALMKQVEEALHQLHARD-KEKQARDMAE---------------------AREEAMNRR--- 123

  Fly   132 LTADSGDAGEVLRSSFVVLGLRKPEKEKSFKRFLAHIANYLRYLQPMHTLDDVLVMCSPFGLENF 196
            |.::|    .||..:|..:....|...       |.||.    ||    :||.:|.......:||
Mouse   124 LASNS----PVLPQAFARVNSISPGSP-------ASIAG----LQ----VDDEIVEFGSVNTQNF 169

  Fly   197 YKTISIGKV 205
            ....::|.|
Mouse   170 QSVQNVGTV 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3589NP_611968.1 Trypsin 296..471 CDD:278516
Trypsin_2 305..445 CDD:290102
Psmd9NP_080276.2 NADB_Rossmann 64..>151 CDD:304358 23/130 (18%)
PDZ_metalloprotease 128..204 CDD:238489 17/70 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.