Sequence 1: | NP_611968.1 | Gene: | CG3589 / 37966 | FlyBaseID: | FBgn0035065 | Length: | 509 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_080276.2 | Gene: | Psmd9 / 67151 | MGIID: | 1914401 | Length: | 222 | Species: | Mus musculus |
Alignment Length: | 204 | Identity: | 42/204 - (20%) |
---|---|---|---|
Similarity: | 69/204 - (33%) | Gaps: | 63/204 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 LKIRHALLEVTSPPAAKQSAIIINNELIISSGSILQPHLAVDGDKGAQNKAIVARLQRGQLLDVQ 67
Fly 68 NEEQEEDAQI-RSLHFVATFDPQQRRPRPIAAPGSRQPHILSRFTAHPLYVFCANEVCRNLHHIL 131
Fly 132 LTADSGDAGEVLRSSFVVLGLRKPEKEKSFKRFLAHIANYLRYLQPMHTLDDVLVMCSPFGLENF 196
Fly 197 YKTISIGKV 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3589 | NP_611968.1 | Trypsin | 296..471 | CDD:278516 | |
Trypsin_2 | 305..445 | CDD:290102 | |||
Psmd9 | NP_080276.2 | NADB_Rossmann | 64..>151 | CDD:304358 | 23/130 (18%) |
PDZ_metalloprotease | 128..204 | CDD:238489 | 17/70 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0265 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |