DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3589 and HTRA1

DIOPT Version :9

Sequence 1:NP_611968.1 Gene:CG3589 / 37966 FlyBaseID:FBgn0035065 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_002766.1 Gene:HTRA1 / 5654 HGNCID:9476 Length:480 Species:Homo sapiens


Alignment Length:319 Identity:67/319 - (21%)
Similarity:115/319 - (36%) Gaps:92/319 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 CLFAISNALPLGCEGSAVFNNKLRLVGIVICTSFQ--------------------RHHENV---- 254
            |...:...:|.|...||....:.: .|:.:|.|.:                    |..|.:    
Human    83 CGEGLQCVVPFGVPASATVRRRAQ-AGLCVCASSEPVCGSDANTYANLCQLRAASRRSERLHRPP 146

  Fly   255 -----------------NLTLAANFGYLLRNFMEQLGMSTTAFQLSRE-PSSFAWERTIVVIESA 301
                             :|....||   :.:.:|::..:....:|.|: |.|   :|.:.|...:
Human   147 VIVLQRGACGQGQEDPNSLRHKYNF---IADVVEKIAPAVVHIELFRKLPFS---KREVPVASGS 205

  Fly   302 GQQGTGTFIRVHNKRFILTCAHVVGQ----NIETVNCRAADREFQSEVIWCNPDSDKPFDLALLT 362
            |      || |.....|:|.||||..    .:|..|....:.:.:        |.|:..|:||:.
Human   206 G------FI-VSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIK--------DVDEKADIALIK 255

  Fly   363 APQD--VPEQCCVRLAR-SPATVGQMVYNAGFPYYVNFSFRHDFNPSIFQ-----GRVI---KCD 416
            ....  :|   .:.|.| |....|:.|...|.|    ||.::.....|..     |:.:   ..|
Human   256 IDHQGKLP---VLLLGRSSELRPGEFVVAIGSP----FSLQNTVTTGIVSTTQRGGKELGLRNSD 313

  Fly   417 TGAIMSDGSVQAGQSGGPMFDQNGCILGVCVSNIKLDDVVYPNINTAIPICDIRNTLQQ 475
            ...|.:|..:..|.||||:.:.:|.::|  ::.:|    |...|:.|||...|:..|.:
Human   314 MDYIQTDAIINYGNSGGPLVNLDGEVIG--INTLK----VTAGISFAIPSDKIKKFLTE 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3589NP_611968.1 Trypsin 296..471 CDD:278516 47/189 (25%)
Trypsin_2 305..445 CDD:290102 37/154 (24%)
HTRA1NP_002766.1 IB 35..111 CDD:197525 6/28 (21%)
KAZAL 115..155 CDD:197624 2/39 (5%)
DegQ 154..480 CDD:223343 57/247 (23%)
Serine protease 204..364 46/187 (25%)
Trypsin_2 204..342 CDD:290102 39/161 (24%)
PDZ_serine_protease 382..473 CDD:238487
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.