powered by:
Protein Alignment CG3589 and psmd9
DIOPT Version :9
Sequence 1: | NP_611968.1 |
Gene: | CG3589 / 37966 |
FlyBaseID: | FBgn0035065 |
Length: | 509 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001002436.2 |
Gene: | psmd9 / 436709 |
ZFINID: | ZDB-GENE-030131-431 |
Length: | 211 |
Species: | Danio rerio |
Alignment Length: | 32 |
Identity: | 6/32 - (18%) |
Similarity: | 19/32 - (59%) |
Gaps: | 0/32 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 50 QNKAIVARLQRGQLLDVQNEEQEEDAQIRSLH 81
:|:|:|:|:....:..:...:.:.:.||::.:
Zfish 6 ENRAVVSRMTEEDVRQLIKRKDDIEEQIKAYY 37
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0265 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.