DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3589 and htra1a

DIOPT Version :9

Sequence 1:NP_611968.1 Gene:CG3589 / 37966 FlyBaseID:FBgn0035065 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001002219.1 Gene:htra1a / 431766 ZFINID:ZDB-GENE-040704-64 Length:479 Species:Danio rerio


Alignment Length:240 Identity:61/240 - (25%)
Similarity:103/240 - (42%) Gaps:47/240 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 HENVN-LTLAANFGYLLRNFMEQLGMSTTAFQLSREPSSFAWERTIVVIESAGQQGTGTFIRVHN 314
            |:|.| |....||   :.:.:|::..:....:|.|:   ..:.:.    |.|...|:| |: |.:
Zfish   158 HDNPNSLRYKYNF---IADVVEKIAPAVVHIELYRK---MVYSKR----EMAVASGSG-FV-VSD 210

  Fly   315 KRFILTCAHVVGQ----NIETVNCRAADREFQSEVIWCNPDSDKPFDLALLTAPQDVPEQCCVRL 375
            ...|:|.||||..    .:|..|..:.|.:.:        |.|:..|:||:..  |:|.:..|.|
Zfish   211 DGLIVTNAHVVANKNRVKVELKNGASYDAKIK--------DVDEKADIALIKI--DLPNKLPVLL 265

  Fly   376 ARSPATV--GQMVYNAGFPYYVNFSFRHDFNPSIFQ-----GRVI---KCDTGAIMSDGSVQAGQ 430
            ....|.:  |:.|...|.|    ||.::.....|..     |:.:   ..|...|.:|..:..|.
Zfish   266 LGRSADLRPGEFVVAIGSP----FSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGN 326

  Fly   431 SGGPMFDQNGCILGVCVSNIKLDDVVYPNINTAIPICDIRNTLQQ 475
            ||||:.:.:|.::|  ::.:|    |...|:.|||...||..|.:
Zfish   327 SGGPLVNLDGEVIG--INTLK----VTAGISFAIPSDKIRQFLAE 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3589NP_611968.1 Trypsin 296..471 CDD:278516 50/188 (27%)
Trypsin_2 305..445 CDD:290102 40/153 (26%)
htra1aNP_001002219.1 IGFBP 31..87 CDD:278641
KAZAL_FS 111..153 CDD:238052
DegQ 160..479 CDD:223343 60/238 (25%)
Serine protease 203..363 49/181 (27%)
Trypsin_2 203..341 CDD:290102 41/155 (26%)
PDZ_serine_protease 380..472 CDD:238487
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.