DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3589 and HtrA2

DIOPT Version :9

Sequence 1:NP_611968.1 Gene:CG3589 / 37966 FlyBaseID:FBgn0035065 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001262565.1 Gene:HtrA2 / 41756 FlyBaseID:FBgn0038233 Length:422 Species:Drosophila melanogaster


Alignment Length:403 Identity:90/403 - (22%)
Similarity:150/403 - (37%) Gaps:118/403 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 IAAPGS-RQPHILSRFTAHP-LYVFCANEVCRNLHHILLTAD---SGDAGEVLRSSFVVLGLRKP 155
            :|..|| |...|..|..|.| |:...||.  |:....:...|   :|::|:..::.        .
  Fly     1 MALRGSHRLEVIFKRCIASPVLHSHAANR--RSSQLAIKEGDPNSNGNSGQYQQNG--------E 55

  Fly   156 EKEKSFKRFLAHIANYLRYLQPMHTLDDVLVMCSPFGLENFYKTISIGKVSNVMGRSGCLFAISN 220
            :|||.::|.       :|:..|...  ..:|..:....|:...||:..|::   ||......|::
  Fly    56 QKEKGWRRL-------VRFFVPFSL--GAVVSAAIIQREDLTPTIAASKMT---GRRRDFNFIAD 108

  Fly   221 ALPLGCEGSAVFNNKLRLVGIVICTSFQRHHENVNLTLAANFGYLLRNFMEQLGMSTTAFQLSRE 285
            .: .||..|.|:                     :.:....:|.|.       .|...||      
  Fly   109 VV-AGCADSVVY---------------------IEIKDTRHFDYF-------SGQPITA------ 138

  Fly   286 PSSFAWERTIVVIESAGQQGTGTFIRVHNKRFILTCAHVVGQNIET-VNCRAAD-REFQSEVIWC 348
                             ..|:| || :.....|||.||||.....| |..|.:| |.|.:.:   
  Fly   139 -----------------SNGSG-FI-IEQNGLILTNAHVVINKPHTMVQVRLSDGRTFPATI--- 181

  Fly   349 NPDSDKPFDLALLTAPQDVPEQCCVRLARSPATV--GQMVYNAGFPYYVNFSFRHDFNPSIFQGR 411
             .|.|:..|||.|..  .|.....:||.:| :|:  |:.|...|.|..:        :.::..|.
  Fly   182 -EDVDQTSDLATLRI--QVNNLSVMRLGKS-STLRSGEWVVALGSPLAL--------SNTVTAGV 234

  Fly   412 VIKC------------DTGAIMSDGSVQAGQSGGPMFDQNGCILGVCVSNIKLDDVVYPNINTAI 464
            :...            |...:.:|.::..|.||||:.:.:|..:|  |:::|    |...|:.||
  Fly   235 ISSTQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIG--VNSMK----VTAGISFAI 293

  Fly   465 PICDIRNTLQQFA 477
            ||..::..|::.|
  Fly   294 PIDYVKVFLERAA 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3589NP_611968.1 Trypsin 296..471 CDD:278516 50/190 (26%)
Trypsin_2 305..445 CDD:290102 41/155 (26%)
HtrA2NP_001262565.1 DegQ 67..422 CDD:223343 70/320 (22%)
Trypsin_2 141..280 CDD:290102 42/157 (27%)
PDZ_serine_protease 323..417 CDD:238487
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.