DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3589 and CG9588

DIOPT Version :9

Sequence 1:NP_611968.1 Gene:CG3589 / 37966 FlyBaseID:FBgn0035065 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster


Alignment Length:202 Identity:50/202 - (24%)
Similarity:81/202 - (40%) Gaps:53/202 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AAKQ--SAIIINNELIISSGSILQPHLAVDGDKGAQNKAIV--ARLQRGQLLDVQNEEQEEDAQI 77
            |.||  :.|..|.:::.::.::......||.:...:|...|  .||.|..::.:||:.:|...||
  Fly    17 AKKQLEAQINRNGQILAANDNVGMSGPLVDAEGFPRNDIDVYQVRLARQTIICLQNDHKELMNQI 81

  Fly    78 RSL----HF-VATFDPQ-QRRPRPIAAPGSRQP---HILSRFTAHPLYVFCANEVCRNLHHILLT 133
            ::|    |. :||.||: ..|...:.....|.|   :|.....|..:.|  .|         |::
  Fly    82 QTLLNQYHSEIATTDPELVNRASALDLDSDRSPGGANITDLAPARAIVV--VN---------LVS 135

  Fly   134 ADS---------GDAGEVLRSSFVVLGLRKPEKEKSFKRFLAHIANYLRYLQPMHT--------- 180
            .||         |||  :||...:..|        :||..||.|...:|.:|..:.         
  Fly   136 PDSPAERAGLCAGDA--ILRFGSINSG--------NFKGDLAQIGELVRNMQSQNVQLKVKRGEQ 190

  Fly   181 -LDDVLV 186
             ||.:||
  Fly   191 QLDLILV 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3589NP_611968.1 Trypsin 296..471 CDD:278516
Trypsin_2 305..445 CDD:290102
CG9588NP_650301.1 PDZ 116..186 CDD:238080 20/90 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.