DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3589 and Htra4

DIOPT Version :9

Sequence 1:NP_611968.1 Gene:CG3589 / 37966 FlyBaseID:FBgn0035065 Length:509 Species:Drosophila melanogaster
Sequence 2:XP_036010000.1 Gene:Htra4 / 330723 MGIID:3036260 Length:499 Species:Mus musculus


Alignment Length:296 Identity:71/296 - (23%)
Similarity:108/296 - (36%) Gaps:89/296 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 MGRSGCLFAISNALPLGCEGSAV--------FNNKLRLVGIVICTSFQRHH-ENVNLTLAANFGY 264
            :|..||.....:|:..|.:|...        .|...|..|.:.....|:.. |....|.|   |.
Mouse   153 LGTCGCAEGAEDAVVCGSDGRTYPSLCALRKENRAARQRGALPAVPVQKGACEEAGTTRA---GR 214

  Fly   265 LLRNF------MEQLGMSTTAFQLSRE--------PSSFAWERTIVVIESAGQQGTGTFIRVHNK 315
            |.|.:      :|::..|....||.|.        |||               .|:| || |...
Mouse   215 LRRKYNFIAAVVEKVAPSVVHLQLFRRSPLTNQEIPSS---------------SGSG-FI-VSED 262

  Fly   316 RFILTCAHVV--GQNIETVNCRAADREFQSEVIWCNPDSDKPFDLALLTAPQDVPEQCCVRLARS 378
            ..|:|.|||:  .|.|: |..::..| :::.|    .|.|...||||:....|           :
Mouse   263 GLIVTNAHVLTNQQKIQ-VELQSGAR-YEATV----KDIDHKLDLALIKIEPD-----------N 310

  Fly   379 PATVGQMVYNAGFPYYVNFSFRHDFNPSIFQGRVI---KCDTGAIMSDGSVQAGQSGGPMFDQNG 440
            ..|.|          .|:.:.|        .||.:   ..|...|.:|..:..|.||||:.:.:|
Mouse   311 TVTAG----------IVSTTQR--------GGRELGLKNSDIDYIQTDAIINHGNSGGPLVNLDG 357

  Fly   441 CILGVCVSNIKLDDVVYPNINTAIPICDIRNTLQQF 476
            .::|  ::.:|    |...|:.|||...||..|:.:
Mouse   358 DVIG--INTLK----VTAGISFAIPSDRIRQFLEDY 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3589NP_611968.1 Trypsin 296..471 CDD:278516 45/179 (25%)
Trypsin_2 305..445 CDD:290102 37/144 (26%)
Htra4XP_036010000.1 IGFBP 85..139 CDD:395164
Kazal_2 156..204 CDD:400135 9/47 (19%)
degP_htrA_DO 222..>494 CDD:273938 55/224 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.