DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3589 and Htra2

DIOPT Version :9

Sequence 1:NP_611968.1 Gene:CG3589 / 37966 FlyBaseID:FBgn0035065 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001100069.1 Gene:Htra2 / 297376 RGDID:1308906 Length:458 Species:Rattus norvegicus


Alignment Length:224 Identity:58/224 - (25%)
Similarity:87/224 - (38%) Gaps:66/224 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 LSREPSSFAWERTIVVIESAGQQGTGTFIRVHNKRFILTCAHVVGQNIETVNCRAADREFQSEVI 346
            |.|.|.|   .|.:.:...:|      || |.:...|:|.||||           |||.   .|.
  Rat   167 LDRHPFS---GREVPISNGSG------FI-VASDGLIVTNAHVV-----------ADRR---RVR 207

  Fly   347 WCNPDSDKPFDLALLTAPQDVPEQCCVR-----------LARSPATV--GQMVYNAGFPYYVNFS 398
            ...|..| .:: |::||...|.:...:|           |.|| |.|  |:.|...|.|:.:   
  Rat   208 VRLPSGD-TYE-AMVTAVDPVADIATLRIQTKEPLPTLPLGRS-ADVRQGEFVVAMGSPFAL--- 266

  Fly   399 FRHDFNPSIFQGRVIKCDTGA------------IMSDGSVQAGQSGGPMFDQNGCILGVCVSNIK 451
                 ..:|..|.|......|            |.:|.::..|.||||:.:.:|.::|  |:.:|
  Rat   267 -----QNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIG--VNTMK 324

  Fly   452 LDDVVYPNINTAIPICDIRNTLQQFARTN 480
                |...|:.|||...:|..|.:..:.|
  Rat   325 ----VTAGISFAIPSDRLREFLHRGEKKN 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3589NP_611968.1 Trypsin 296..471 CDD:278516 50/199 (25%)
Trypsin_2 305..445 CDD:290102 41/164 (25%)
Htra2NP_001100069.1 DegQ 140..454 CDD:223343 58/224 (26%)
Trypsin_2 182..320 CDD:290102 43/171 (25%)
PDZ_serine_protease 360..452 CDD:238487
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.