DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3589 and HTRA2

DIOPT Version :9

Sequence 1:NP_611968.1 Gene:CG3589 / 37966 FlyBaseID:FBgn0035065 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_037379.1 Gene:HTRA2 / 27429 HGNCID:14348 Length:458 Species:Homo sapiens


Alignment Length:234 Identity:56/234 - (23%)
Similarity:88/234 - (37%) Gaps:68/234 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 GTGTFIRVHNKRFILTCAHVVGQNIETVNCRAADREFQSEVIWCNPDSDKPFDLALLTAPQDVPE 369
            |:|..:....  .|:|.||||           |||. :..|...:.|:.:    |::||...|.:
Human   182 GSGFVVAADG--LIVTNAHVV-----------ADRR-RVRVRLLSGDTYE----AVVTAVDPVAD 228

  Fly   370 QCCVR-----------LARSPATV--GQMVYNAGFPYYVNFSFRHDFNPSIFQGRVIKCDTGA-- 419
            ...:|           |.|| |.|  |:.|...|.|:.:        ..:|..|.|......|  
Human   229 IATLRIQTKEPLPTLPLGRS-ADVRQGEFVVAMGSPFAL--------QNTITSGIVSSAQRPARD 284

  Fly   420 ----------IMSDGSVQAGQSGGPMFDQNGCILGVCVSNIKLDDVVYPNINTAIPICDIRNTLQ 474
                      |.:|.::..|.||||:.:.:|.::|  |:.:|    |...|:.|||...:|..|.
Human   285 LGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIG--VNTMK----VTAGISFAIPSDRLREFLH 343

  Fly   475 QFARTNDLNVLSN----------LVASPDVHRVWSLEMP 503
            :..:.|..:.:|.          |..||.:.....|..|
Human   344 RGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREP 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3589NP_611968.1 Trypsin 296..471 CDD:278516 47/190 (25%)
Trypsin_2 305..445 CDD:290102 39/164 (24%)
HTRA2NP_037379.1 IAP-binding motif 134..137
DegQ 150..>453 CDD:333159 56/234 (24%)
Serine protease 166..342 48/192 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.