DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3589 and HTRA4

DIOPT Version :9

Sequence 1:NP_611968.1 Gene:CG3589 / 37966 FlyBaseID:FBgn0035065 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_710159.1 Gene:HTRA4 / 203100 HGNCID:26909 Length:476 Species:Homo sapiens


Alignment Length:399 Identity:87/399 - (21%)
Similarity:138/399 - (34%) Gaps:133/399 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 CLFAISNALP--LGCE--GSAVF----------------NNKLRLVGIVICTSFQRHHENVNLTL 258
            ||..:....|  .||.  |.||.                |...|.:|.|.....|  ..|...|.
Human    94 CLQPLRPGFPSTCGCPTLGGAVCGSDRRTYPSMCALRAENRAARRLGKVPAVPVQ--WGNCGDTG 156

  Fly   259 AANFGYLLRNF------MEQLGMSTTAFQLSREPSSFAWER-----TIVVIESAGQQGTGTFIRV 312
            ..:.|.|.||:      :|::..|....||        |.|     .:|.:.|    |:| || |
Human   157 TRSAGPLRRNYNFIAAVVEKVAPSVVHVQL--------WGRLLHGSRLVPVYS----GSG-FI-V 207

  Fly   313 HNKRFILTCAHVV--GQNIETVNCRAADREFQSEVIWCNPDSDKPFDLALLTAPQDVPEQCCVRL 375
            .....|:|.||||  .|.||.|....|  .:::.|    .|.|...|||::....:. |...:.|
Human   208 SEDGLIITNAHVVRNQQWIEVVLQNGA--RYEAVV----KDIDLKLDLAVIKIESNA-ELPVLML 265

  Fly   376 AR-SPATVGQMVYNAGFPYYVNFSFRHDFNPSIFQ-----GRVI---KCDTGAIMSDGSVQAGQS 431
            .| |....|:.|...|.|    ||.::.....|..     |:.:   ..|...:..|.::..|.|
Human   266 GRSSDLRAGEFVVALGSP----FSLQNTATAGIVSTKQRGGKELGMKDSDMDYVQIDATINYGNS 326

  Fly   432 GGPMFDQNGCILGVCVSNIKLDDVV---------------------------------------- 456
            |||:.:.:|.::|  |:::::.|.:                                        
Human   327 GGPLVNLDGDVIG--VNSLRVTDGISFAIPSDRVRQFLAEYHEHQMKGKAFSNKKYLGLQMLSLT 389

  Fly   457 -------------YPNINTAIPICD-IRNTLQQFARTNDLNVLSNLVASP-----DVHRVW---S 499
                         :|::::.:.:|. :..|..|.:...|.:|:.|:...|     ||.:..   |
Human   390 VPLSEELKMHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTDVVKALDSDS 454

  Fly   500 LEMPPIRSK 508
            |.|..:|.|
Human   455 LSMAVLRGK 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3589NP_611968.1 Trypsin 296..471 CDD:278516 49/239 (21%)
Trypsin_2 305..445 CDD:290102 42/150 (28%)
HTRA4NP_710159.1 IGFBP 40..94 CDD:278641 87/399 (22%)
Kazal_2 108..152 CDD:284958 9/45 (20%)
DegQ 156..470 CDD:223343 72/335 (21%)
Serine protease 202..362 45/174 (26%)
Trypsin_2 202..340 CDD:290102 43/152 (28%)
PDZ_serine_protease 380..470 CDD:238487 15/84 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.