DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3589 and htra4

DIOPT Version :9

Sequence 1:NP_611968.1 Gene:CG3589 / 37966 FlyBaseID:FBgn0035065 Length:509 Species:Drosophila melanogaster
Sequence 2:XP_017211746.2 Gene:htra4 / 100334257 ZFINID:ZDB-GENE-131120-192 Length:459 Species:Danio rerio


Alignment Length:238 Identity:56/238 - (23%)
Similarity:88/238 - (36%) Gaps:61/238 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 SREPSSFAWERTIV--VIESAG---------------------QQGTGTFIRVHNKRFILTCAHV 324
            ||.|||..::...:  |::...                     ..|:| || |....:|:|.|||
Zfish   139 SRNPSSMRYKFNFIADVVDKIAPAVVHLELFSRLPFSNQDVPVSSGSG-FI-VSEDGWIVTNAHV 201

  Fly   325 VGQ----NIETVNCRAADREFQSEVIWCNPDSDKPFDLALLTAPQDVPEQCCVRLARSPATVGQM 385
            :..    .:|..|....|...:        |.|:..|:||:....:......:....|....|:.
Zfish   202 LSNKQRIKVELKNGMLYDATIK--------DVDQKLDIALIKIDSETALPVLLLGRSSDLRPGEF 258

  Fly   386 VYNAGFPYYVNFSFRHDFNPSIFQ-----GRVI---KCDTGAIMSDGSVQAGQSGGPMFDQNGCI 442
            |...|.|    ||.::.....|..     |..:   ..|...|.:|..:..|.||||:.:.:|.:
Zfish   259 VVAVGSP----FSLQNTVTTGIISTTHRGGHELGLQNSDMEYIQTDAIINYGNSGGPLVNLDGDV 319

  Fly   443 LGVCVSNIKLDDVVYPNINTAIPICDIRNTL------QQFART 479
            :|  ::.:|    |.|.|:.|||...||..|      |:..||
Zfish   320 IG--INTLK----VTPGISFAIPSDRIRQFLADSYERQRKGRT 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3589NP_611968.1 Trypsin 296..471 CDD:278516 46/209 (22%)
Trypsin_2 305..445 CDD:290102 36/151 (24%)
htra4XP_017211746.2 IGFBP 27..80 CDD:306685
KAZAL_FS 92..135 CDD:238052
DegQ 118..459 CDD:223343 56/238 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.