DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3589 and LOC100331049

DIOPT Version :9

Sequence 1:NP_611968.1 Gene:CG3589 / 37966 FlyBaseID:FBgn0035065 Length:509 Species:Drosophila melanogaster
Sequence 2:XP_002665901.2 Gene:LOC100331049 / 100331049 -ID:- Length:301 Species:Danio rerio


Alignment Length:213 Identity:47/213 - (22%)
Similarity:79/213 - (37%) Gaps:58/213 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 AFQLSREPSSFAWERTIVVIESAGQQGTGTFIRVHNKRFILTCAHVVGQ---------NIETVNC 334
            |..::|.|.|   .|.:.:...:|      || :.:...|:|..|||..         |.||.|.
Zfish     6 AVHITRHPFS---GREVPISNGSG------FI-ISSDDLIVTNGHVVANKRGVCVKLTNGETYNT 60

  Fly   335 RAADREFQSEVIWCNPDSDKPFDLALLTAPQDVPEQCCVRLARSPATVGQMVYNAGFPYYVNFSF 399
            ...|.:..:::.....:...|.....|....||.:             |:.|...|    ..||.
Zfish    61 TVQDVDQAADIATIKINVKNPLPTLRLGKSSDVRQ-------------GEFVVAMG----SLFSL 108

  Fly   400 RHDFNPSIFQGRVIKCDTGA------------IMSDGSVQAGQSGGPMFDQNGCILGVCVSNIKL 452
            ::    :|..|.|.....|:            |.:|.::..|.||||:.:.:|.::|  ::.:| 
Zfish   109 KN----TITSGIVSFAQRGSKELGLSNSNMDYIQTDATIDFGNSGGPLINLDGEVIG--INTMK- 166

  Fly   453 DDVVYPNINTAIPICDIR 470
               |...|:.|||...:|
Zfish   167 ---VTAGISFAIPSDRVR 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3589NP_611968.1 Trypsin 296..471 CDD:278516 42/196 (21%)
Trypsin_2 305..445 CDD:290102 33/160 (21%)
LOC100331049XP_002665901.2 Trypsin_2 24..162 CDD:290102 35/167 (21%)
PDZ_serine_protease 203..287 CDD:238487
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1307240at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.