DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3589 and si:dkey-33c12.12

DIOPT Version :10

Sequence 1:NP_611968.1 Gene:CG3589 / 37966 FlyBaseID:FBgn0035065 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001082916.2 Gene:si:dkey-33c12.12 / 100000024 ZFINID:ZDB-GENE-081028-30 Length:214 Species:Danio rerio


Alignment Length:58 Identity:18/58 - (31%)
Similarity:33/58 - (56%) Gaps:6/58 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 IMSDGSVQAGQSGGPMFDQNGCILGVCVSNIKLDDVVYPNINTAIPICDIRNTLQQFA 477
            |.:|.::..|.||||:.:.:|.::|  ::.:|    |...|:.|||:..:|..|.:.|
Zfish    36 IQTDATIDFGNSGGPLINLDGEVIG--INTMK----VTAGISFAIPLGRVRLFLDRSA 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3589NP_611968.1 Trypsin_2 305..445 CDD:433149 8/24 (33%)
si:dkey-33c12.12NP_001082916.2 DegQ <1..197 CDD:440035 18/58 (31%)
cpPDZ_HtrA-like 101..198 CDD:467624
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.