DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3594 and RBM19

DIOPT Version :9

Sequence 1:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001140170.1 Gene:RBM19 / 9904 HGNCID:29098 Length:960 Species:Homo sapiens


Alignment Length:199 Identity:60/199 - (30%)
Similarity:89/199 - (44%) Gaps:37/199 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 RNPSDPE---DSKSEDEAKSDDEAAAEGSAASGAEEEESAENGQITSDQLSSLLRGASKTNRHVL 116
            ::|::||   |.::.::....:|.|...||....||||..|.        ...|.|.:      |
Human   682 KDPAEPETVPDGETPEDENPTEEGADNSSAKMEEEEEEEEEE--------EESLPGCT------L 732

  Fly   117 YVTNLNFETTKDDLELHFSAAGTVKSIRIPKKRRG-------GFAFVEMADLSSFQNAF-QLHNT 173
            ::.||||:||::.|:..||..|||||..|.||:..       ||.|||.......|.|. ||...
Human   733 FIKNLNFDTTEEKLKEVFSKVGTVKSCSISKKKNKAGVLLSMGFGFVEYRKPEQAQKALKQLQGH 797

  Fly   174 ELQGRNIKVQISEAGKKKS---ANKKNI-IKQKNRKL--------AEMRNEQKTFTKSGKFYDKD 226
            .:.|..::|:|||...|.:   |.||.: .||...|:        |..|..::.|:..|:.....
Human   798 VVDGHKLEVRISERATKPAVTLARKKQVPRKQTTSKILVRNIPFQAHSREIRELFSTFGELKTVR 862

  Fly   227 LKKE 230
            |.|:
Human   863 LPKK 866

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3594NP_523855.1 RRM3_Prp24 114..184 CDD:240744 29/77 (38%)
RBM19NP_001140170.1 RRM <2..>104 CDD:223796
RRM1_RBM19 2..77 CDD:241008
RRM_u2 82..286 CDD:293257
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..119
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..294
RRM <270..450 CDD:223796
RRM2_RMB19 294..365 CDD:240946
RRM <400..>500 CDD:223796
RRM3_RBM19 400..478 CDD:241011
RRM 477..801 CDD:223796 42/132 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 491..513
RRM4_RBM19 587..658 CDD:241013
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 667..729 14/54 (26%)
RRM5_RBM19_like 730..809 CDD:240764 29/84 (35%)
RRM6_RBM19 832..910 CDD:241015 7/35 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0110
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.