DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3594 and SAFB2

DIOPT Version :10

Sequence 1:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_055464.1 Gene:SAFB2 / 9667 HGNCID:21605 Length:953 Species:Homo sapiens


Alignment Length:212 Identity:63/212 - (29%)
Similarity:93/212 - (43%) Gaps:39/212 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PSDPE--DSKSEDEAKSDDEAA-------AEGSAASGAEE-----EESAENGQITSDQLSSLLRG 107
            || ||  ||| ||..|.|.:|.       .|.|.:.||::     :|..:...|..|:...:..|
Human   342 PS-PEARDSK-EDGRKFDFDACNEVPPAPKESSTSEGADQKMSSFKEEKDIKPIIKDEKGRVGSG 404

  Fly   108 ASKTNRHVLYVTNLNFETTKDDLELHFSAAG------TVKSIRIPKKRRGGFAFVEMADLSSFQN 166
            :.:.    |:|:.|:..|...||:..||..|      .|.:.|.|..|..||..:..:| .:.:.
Human   405 SGRN----LWVSGLSSTTRATDLKNLFSKYGKVVGAKVVTNARSPGARCYGFVTMSTSD-EATKC 464

  Fly   167 AFQLHNTELQGRNIKVQISEAGKKKSANKKNIIKQKNRKLAEMRNEQKTFTKSGKFYDKDLKKEK 231
            ...||.|||.||.|.|   |..|.:.|.|    |..:||..|::.|:  .:...:.:..::|.||
Human   465 ISHLHRTELHGRMISV---EKAKNEPAGK----KLSDRKECEVKKEK--LSSVDRHHSVEIKIEK 520

  Fly   232 A---KEMLARKRWRKKP 245
            .   ||....|:..|||
Human   521 TVIKKEEKIEKKEEKKP 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3594NP_523855.1 SF-CC1 36..>197 CDD:273721 49/159 (31%)
RRM 116..187 CDD:440488 25/76 (33%)
SAFB2NP_055464.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
SAP 30..64 CDD:128789
PLN03124 31..>153 CDD:215591
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..114
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..404 19/63 (30%)
RRM_SAFB1_SAFB2 406..481 CDD:410080 25/82 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 525..665 6/13 (46%)
Interaction with SAFB1 600..953
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 684..953
Nuclear localization signal. /evidence=ECO:0000255 713..730
RcnB 756..>843 CDD:444206
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.