DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3594 and RBM39

DIOPT Version :10

Sequence 1:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_909122.1 Gene:RBM39 / 9584 HGNCID:15923 Length:530 Species:Homo sapiens


Alignment Length:112 Identity:35/112 - (31%)
Similarity:47/112 - (41%) Gaps:17/112 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 DLELHFSAAGTVKSIRI----PKKRRGGFAFVEMADLSSFQNAFQLHNTELQGRNIKVQISEAGK 189
            |||..||..|.|:.:|:    ..:|..|.|:||..|:||...|..|....:.|..|.||.|:|  
Human   168 DLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQA-- 230

  Fly   190 KKSANKKNIIKQKNRKLAEMRNEQKTFTKSGKFYDKDLKKEKAKEML 236
                       :|||..|...|.||......:.|...|.....::||
Human   231 -----------EKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDML 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3594NP_523855.1 SF-CC1 36..>197 CDD:273721 24/71 (34%)
RRM 116..187 CDD:440488 23/61 (38%)
RBM39NP_909122.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..146
SF-CC1 46..518 CDD:273721 35/112 (31%)
Interaction with JUN. /evidence=ECO:0000250|UniProtKB:Q8VH51 291..406
Activating domain. /evidence=ECO:0000250|UniProtKB:Q8VH51 291..355
Interaction with ESR1 and ESR2. /evidence=ECO:0000250|UniProtKB:Q8VH51 355..406
Interaction with NCOA6. /evidence=ECO:0000250|UniProtKB:Q8VH51 406..530
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.